Recombinant humaan C-X-C Motif Chemokine 12/CXCL12/SDF-1 (22-89)
Gecertificeerd

Recombinant humaan C-X-C Motif Chemokine 12/CXCL12/SDF-1 (22-89)

Catalog #: 32-7104-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :8.12kD. Recombinant Human C-X-C Motif Chemokine 12 is produced by our E.coli expression system and the target gene encoding Lys22-Lys89 is expressed. Stromal Cell-Derived Factor-1 (SDF-1) is a chemokine member of the intercrine family. SDF1 is expressed as five isoforms that differ only in the C terminal tail. SDF1a and SDF1 beta are identical except for the four residues present in the C-terminus of SDF1 beta but absent from SDF1a. SDF1 isoforms interact with CXCR4 and CXCR7 receptors on the cell surface, and can also bind syndecan4. SDF1 is known to influence lymphopoiesis, regulate patterning and cell number of neural progenitors, and promote angiogenesis. It also enhances the survival of myeloid progenitor cells.

Gene Name

CXCL12

Gene ID

6387

UniProt

P48061

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Beschrijving

Source: E.coli. MW :8.12kD. Recombinant Human C-X-C Motif Chemokine 12 is produced by our E.coli expression system and the target gene encoding Lys22-Lys89 is e

Specificaties

ProductnaamRecombinant humaan C-X-C Motif Chemokine 12/CXCL12/SDF-1 (22-89)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7104-50