Recombinant humaan C-X-C Motif Chemokine 1/CXCL1 (C-6His)

Source: Human Cells. MW :8.9kD. Recombinant Human C-X-C Motif Chemokine 1 is produced by our Mammalian expression system and the target gene encoding Ala35-Asn107 is expressed with a 6His tag at the C-terminus. Chemokine (C-X-C motif) Ligand 1 Protein (CXCL1) is a growth factor for melanoma cells and a chemotaxin for neutrophils and a member of the CXC chemokine family that is a potent neutrophil attractant and activator and is also active toward basophils. CXCL1 is expressed by macrophages, neutrophils and epithelial cells; it has neutrophil chemoattractant activity. CXCL1 plays a critical nonredundant role in the development of experimental Lyme arthritis and carditis via CXCR2-mediated recruitment of neutrophils into the site of infection and may also have important pro-nociceptive effects via its direct actions on sensory neurons, and may induce long-term changes that involve protein synthesis.

CXCL1

2919

P09341

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSNVDHHHHHH