Recombinant humaan C-X-C Motif Chemokine 3/CXCL3/GROgamma (N-6His)
Gecertificeerd

Recombinant humaan C-X-C Motif Chemokine 3/CXCL3/GROgamma (N-6His)

Catalog #: 32-8117-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :10.1kD. Recombinant Human C-X-C Motif Chemokine 3 is produced by our E.coli expression system and the target gene encoding Ala35-Asn107 is expressed with a 6His tag at the N-terminus. C-X-C Motif Chemokine 3 (CXCL3) is a secreted protein that belongs to the intercrine alpha (chemokine CXC) family. CXCL3 controls the migration and adhesion of monocytes and mediates its effect on its target cell by interacting with a cell surface chemokine receptor called CXCR2. In addition, CXCL3 is thought to play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Gene Name

CXCL3

Gene ID

2921

UniProt

P19876

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Beschrijving

Source: E. coli. MW :10.1kD. Recombinant Human C-X-C Motif Chemokine 3 is produced by our E.coli expression system and the target gene encoding Ala35-Asn107 is

Specificaties

ProductnaamRecombinant humaan C-X-C Motif Chemokine 3/CXCL3/GROgamma (N-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8117-10