Recombinant humaan C-X-C Motif Chemokine 5/CXCL5

Source: E. coli. MW :7.95kD. Recombinant Human C-X-C Motif Chemokine 5 is produced by our E.coli expression system and the target gene encoding Leu44-Asn114 is expressed. C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78) . In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers.

CXCL5

6374

P42830

Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 6.0.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN