Recombinant humaan cAMP-afhankelijke proteïne- kinaseremmer bèta/PKI-bèta (N-6His)

Source: E.coli. MW :10.6kD. Recombinant Human PKI-beta is produced by our E.coli expression system and the target gene encoding Met1-Lys78 is expressed with a 6His tag at the N-terminus. cAMP-Dependent Protein Kinase Inhibitor beta (PKI- beta) is a member of the PKI family. It has been shown that PKI- beta is an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity; this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.

PKIB

5570

Q9C010

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 20% Glycerol, pH 8.0.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MGSSHHHHHHSSGLVPRGSHMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK