Recombinant humaan Cathepsine B/CTSB (C-6His)

Source: Human Cells. MW :36.9kD. Recombinant Human Cathepsin B is produced by our Mammalian expression system and the target gene encoding Arg18-Ile339 is expressed with a 6His tag at the C-terminus. Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is a member of the peptidase C1 family. At least five transcript variants encoding the same protein have been found for this gene. Cystatin-B / CSTB is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B. Cystatin-B / CSTB is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. Cystatin-B / CSTB is also thought to play a role in protecting against the proteases leaking from lysosomes

CTSB

1508

P07858

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 17000pmol/min/ug

RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMGYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKIVDHHHHHH