Recombinant humaan CEACAM21 (C-6His)
Gecertificeerd

Recombinant humaan CEACAM21 (C-6His)

Catalog #: 32-7923-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :24.2kD. Recombinant Human CEACAM21 is produced by our Mammalian expression system and the target gene encoding Trp35-Gly240 is expressed with a 6His tag at the C-terminus. Carcinoembryonic antigen-related cell adhesion molecule 21 is a protein that in humans is encoded by the CEACAM21 gene. It belongs to the immunoglobulin superfamily. CEA family.containing 1 Ig-like C2-type (immunoglobulin-like) domain.It was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses.

Gene Name

CEACAM21

Gene ID

90273

UniProt

Q3KPI0

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLGVDHHHHHH

Beschrijving

Source: Human Cells. MW :24.2kD. Recombinant Human CEACAM21 is produced by our Mammalian expression system and the target gene encoding Trp35-Gly240 is expresse

Specificaties

ProductnaamRecombinant humaan CEACAM21 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7923-50