Recombinant humaan cytostatine C/CST3 (C-6His)
Gecertificeerd

Recombinant humaan cytostatine C/CST3 (C-6His)

Catalog #: 32-8435-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :14.4kD. Recombinant Human Cystatin C is produced by our Mammalian expression system and the target gene encoding Ser27-Ala146 is expressed with a 6His tag at the C-terminus. Cystatin C is a member of family 2 of the cystatin superfamily. It is ubiquitous in human tissues and body fluids and mainly used as a biomarker of kidney function. Cystatin C inhibits many cysteine proteases such as papain and Cathepsins B, H, K, L and S. As an inhibitor of cysteine proteinases, Cystatin C is thought to serve an important physiological role as a local regulator of this enzyme activity. Recently, it has been studied for its role in predicting new-onset or deteriorating cardiovascular disease. It also seems to play a role in brain disorders involving amyloid (a specific type of protein deposition), such as Alzheimer's disease.

Gene Name

CST3

Gene ID

1471

UniProt

P01034

Components

Lyophilized from a 0.2 μm filtered solution of 10mM PB, 200mM Nacl, pH6.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDAVDHHHHHH

Beschrijving

Source: Human Cells. MW :14.4kD. Recombinant Human Cystatin C is produced by our Mammalian expression system and the target gene encoding Ser27-Ala146 is expres

Specificaties

ProductnaamRecombinant humaan cytostatine C/CST3 (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8435-10