Recombinant humaan DCN1-achtig eiwit 1/DCUN1D1 (N-6His)

Source: E.coli. MW :32.3kD. Recombinant Human DCN1-Like Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Val259 is expressed with a 6His tag at the N-terminus. DCN1-Like Protein 1 is a protein containing 1 DCUN1 domain and 1 UBA-like domain. DCN1-Like Protein 1 contains part of an E3 Ubiquitin Ligase Complex for Neddylation. It is required for Neddylation of Cullin components of E3 Cullin-RING Ubiquitin Ligase complexes. It enhances the rate of Cullins Neddylation. DCN1-Like Protein 1 recruits the NEDD8-charged E2 Enzyme to the Cullin component. DCUN1D1 is involved in the release of inhibitory effects of CAND1 on the Cullin-RING Ligase E3 complex assembly and activity. It acts also as an oncogene facilitating malignant transformation and carcinogenic progression.

DCUN1D1

54165

Q96GG9

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV