Recombinant humaan eiwit kinase C type e/PKC e/PKCE (C-6His)

Source: E.coli. MW :19.64kD. Recombinant Human PKC epsilon is produced by our E.coli expression system and the target gene encoding Gln580-Pro737 is expressed with a 6His tag at the C-terminus. Protein Kinase C Epsilon type is a member of the serine- and threonine-specific protein kinase family that can be activated by calcium and the second messenger diacylglycerol. Protein Kinase C Epsilon contains these domains: one AGC-kinase C-terminal domain, one C2 domain, one protein kinase domain and two phorbol-ester/DAG-type zinc fingers. Protein Kinase C Epsilon phosphorylate a variety of protein targets and has been identified to participate in diverse cellular signaling pathways. It has many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Protein Kinase C Epsilon also serves as the receptor for phorbol esters, a class of tumor promoters.

PRKCE

5581

Q02156

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.4.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMPLEHHHHHH