Recombinant humaan eiwitfosfaat 1C katalytische subeenheid/PPP1CC (N, C-6His)

Source: E.coli. MW :40.2kD. Recombinant Human PPP1CC is produced by our E.coli expression system and the target gene encoding Met1-Lys323 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Serine/Threonine-Protein Phosphatase PP1-? Catalytic Subunit (PPP1CC) is a member of the PPP phosphatase family. It is essential for cell division, participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. PPP1CC colocalizes with SPZ1 in the nucleus, with URI1 at mitochondrion, Rapidly exchanges between the nucleolar, nucleoplasmic and cytoplasmic compartments. As a cofactor, PPP1CC binds one iron ion and one manganese ion per subunit.. In addition, PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.

PPP1CC

5501

P36873

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0 .

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MGSSHHHHHHSSGLVPRGSHMADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKKLEHHHHHH