
Recombinant humaan EpCAM/TROP1/CD326 (C-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: Human Cells. MW :28.43kD. Recombinant Human EpCAM is produced by our Mammalian expression system and the target gene encoding Gln24-Lys265 is expressed with a 6His tag at the C-terminus. Epithelial Cell Adhesion Molecule (EpCAM) is a signal type I transmembrane glycoprotein that belongs to the EPCAM family. EpCAM is composed of an extracellular domain with one thyroglobulin type-1 domain, a transmembrane domain and a cytoplasmic domain. EpCAM is found on the surface of adenocarcinoma, but not on mesodermal or neural cell membranes. The EpCAM molecule has been shown to function as a homophilic Ca2+ independent adhesion molecule. It may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium as an immunological barrier providing the first line of defense against infection. Defects in EPCAM are a cause of hereditary non-polyposis colorectal cancer type 8 (HNPCC8) and diarrhea type 5 (DIAR5) . EpCAM plays a role in embryonic stem cells proliferation and differentiation; it up-regulates the expression of FABP5, MYC and Cyclin A and Cyclin E. It is highly and selectively expressed by undifferentiated embryonic stem cells.
EPCAM
4072
P16422
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKVDHHHHHH
Beschrijving
Source: Human Cells. MW :28.43kD. Recombinant Human EpCAM is produced by our Mammalian expression system and the target gene encoding Gln24-Lys265 is expressed
Specificaties
Recent bekeken producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL
Recent gezochte producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Fluorescein Conjugated Affinity Purified Anti-MOUSE IgG + IgM (H&L) (GOAT) Minimum Cross Reactivity to Bovine, Horse and Human S
GWB-5CB439
1 mg

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-50mL
50 mL

Horse Polyclonal Horse anti-Rabbit IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7401-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-50mL
50 mL

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse ImmPRESS(TM) VR Secondary Antibody [HRP Polymer]
MP-6402-NB
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-15mL
15 mL
