Recombinant humaan Ethanolaminefosfotransferase 1/EPT1 (N-GST)

Source: E.coli. MW :32.3kD. Recombinant Human EPT1 is produced by our E.coli expression system and the target gene encoding Met1-Pro50 is expressed with a GST tag at the N-terminus. Ethanolaminephosphotransferase 1 (EPT1) is an enzyme that belongs to the CDP-Alcohol Phosphatidyltransferase Class-I Family. EPT1 is a Selenoprotein, which contains a Selenocysteine (Sec) residue at its active site. The Selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of Selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. EPT1 catalyzes Phosphatidylethanolamine biosynthesis from CDP-Ethanolamine. It plays a central role in the formation and maintenance of vesicular membranes. EPT1 is involved in the formation of Phosphatidylethanolamine via the 'Kennedy' pathway.

SELENOI

85465

Q9C0D9

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP