Recombinant humaan Fms-related Tyrosine Kinase 3 ligand/FLT3LG (C-6His)
Gecertificeerd

Recombinant humaan Fms-related Tyrosine Kinase 3 ligand/FLT3LG (C-6His)

Catalog #: 32-7802-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :18.9kD. Recombinant Human Fms-like Tyrosine Kinase 3 Ligand is produced by our Mammalian expression system and the target gene encoding Thr27-Pro184 is expressed with a 6His tag at the C-terminus. Fms-Related Tyrosine Kinase 3 Ligand (FLT3LG) is a hematopoietic four helical bundle cytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1) . In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors by activiation of Flt 3 receptor.

Gene Name

FLT3LG

Gene ID

2323

UniProt

P49771

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPVDHHHHHH

Beschrijving

Source: Human Cells. MW :18.9kD. Recombinant Human Fms-like Tyrosine Kinase 3 Ligand is produced by our Mammalian expression system and the target gene encoding

Specificaties

ProductnaamRecombinant humaan Fms-related Tyrosine Kinase 3 ligand/FLT3LG (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7802-10