Recombinant humaan GITR/TNFRSF18/CD357 (C-Fc)

Source: Human Cells. MW :41.2kD. Recombinant Human GITR is produced by our Mammalian expression system and the target gene encoding Gln26-Gln161 is expressed with a Fc tag at the C-terminus. Glucocorticoid-induced tumor necrosis factor receptor (GITR) is type I transmembrane protein belonging to the TNF R family. It contains 3 TNFR-Cys repeats and it have four isforms: IsformA?isformB and isformC is single-pass type I membrane protein and isformD is a secreted protein. GITR seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. It mediated NF-kappa-B activation via the TRAF2/NIK pathway. It binds to TRAF1, TRAF2, and TRAF3, but not TRAF5 and TRAF6 and binds through its C-terminus to SIVA1/SIVA. It is preferentially expressed in activated T lymphocytes and up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation.

TNFRSF18

8784

Q9Y5U5

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped on dry ice/ice packs.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK