Recombinant humaan glycoproteïne A33/GPA33/GPA33 (C-6His)
Gecertificeerd

Recombinant humaan glycoproteïne A33/GPA33/GPA33 (C-6His)

Catalog #: 32-7428-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :24.66kD. Recombinant Human Glycoprotein A33 is produced by our Mammalian expression system and the target gene encoding Ile22-Val235 is expressed with a 6His tag at the C-terminus. Human Glycoprotein A33 (GPA33) is a single-pass type I membrane protein, belongs to the CTX family of cell adhesion molecular within the immunoglobulin family, can be expressed in normal gastrointestinal epithelium and in 95% of colon cancers. GPA33 consists of one Ig-like C2-type domain and one Ig-like V-type domain. The predicted mature protein includes a single transmembrane domain, a extracellular region and a intracellular tail. Intracellular traffic and recycling to the cell surface appear to play an important role in GPA33 function and to have an influence on its surface density superseding translation regulation. GPA33 has become a promising target of immunologic therapy strategies. GPA33 may also play a important role in cell-cell recognition and signaling.

Gene Name

GPA33

Gene ID

10223

UniProt

Q99795

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVVDHHHHHH

Beschrijving

Source: Human Cells. MW :24.66kD. Recombinant Human Glycoprotein A33 is produced by our Mammalian expression system and the target gene encoding Ile22-Val235 is

Specificaties

ProductnaamRecombinant humaan glycoproteïne A33/GPA33/GPA33 (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7428-10