Recombinant Humaan Hematopoëtisch Lineage Cellspecifiek Proteïne/HCLS1 (C-6His)

Source: Human Cells. MW :55kD. Recombinant Human Hematopoietic lineage cell-specific protein is produced by our Mammalian expression system and the target gene encoding Met1-Glu486 is expressed with a 6His tag at the C-terminus. Hematopoietic lineage cell-specific protein (HCLS1) is a protein that in humans is encoded by the HCLS1 gene. It is expressed only in tissues and cells of hematopoietic origin. It is substrate of the antigen receptor-coupled tyrosine kinase and plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. It may also be involved in the regulation of gene expression.

HCLS1

3059

P14317

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAVDHHHHHHGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE