Recombinant humaan Hepcidine/HAMP (N-GST)

Source: E. coli. MW :2.92kD. Recombinant Human Hepcidin is produced by our E.coli expression system and the target gene encoding Asp60-Thr84 is expressed with a GST tag at the N-terminus. Hepcidin (HAMP) is a secreted protein that belongs to the hepcidin family.It is expressed in liver, heart and brain. It is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta sheet structures.

HAMP

57817

P81172

Supplied as a 0.2 μm filtered solution of PBS,50%glycerol, pH7.4.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDTHFPICIFCCGCCHRSKCGMCCKT