Recombinant humaan interferon omega -1/IFNW1 (C-6His)
Gecertificeerd

Recombinant humaan interferon omega -1/IFNW1 (C-6His)

Catalog #: 32-7922-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :21.1kD. Recombinant Human Interferon omega-1 is produced by our Mammalian expression system and the target gene encoding Leu22-Ser195 is expressed with a 6His tag at the C-terminus. Interferon omega-1 is also known as Interferon alpha-II-1and IFNW1. It is a Secreted protein that in humans is encoded by the IFNW1 gene. IFNW1 belongs to the alpha/beta interferon family. Type I IFNs consist of IFN a, beta, t, and g and bind to the type I IFN receptor, whereas IFN-a is the only type II IFN and is specific for the type II IFN receptor. IFNW1 is a recently discovered protein structurally related to IFN-alpha and –beta. It has been shown that IFN-omega 1 similar to that of other human class I IFNs; potent antiviral activity was also observed on cells of bovine and ovine but not of equine or murine origin.

Gene Name

IFNW1

Gene ID

3467

UniProt

P05000

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSSVDHHHHHH

Beschrijving

Source: Human Cells. MW :21.1kD. Recombinant Human Interferon omega-1 is produced by our Mammalian expression system and the target gene encoding Leu22-Ser195 i

Specificaties

ProductnaamRecombinant humaan interferon omega -1/IFNW1 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7922-50