Recombinant humaan Leucine-Rich-herhalingseiwit 3B/LRRC3B (C-6His)
Gecertificeerd

Recombinant humaan Leucine-Rich-herhalingseiwit 3B/LRRC3B (C-6His)

Catalog #: 32-7585-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :20kD. Recombinant Human LRRC3B is produced by our Mammalian expression system and the target gene encoding Cys34-Tyr204 is expressed with a 6His tag at the C-terminus. Leucine-Rich Repeat-Containing Protein 3B (LRRC3B) belongs to the LRRC3 family. LRRC3B is single-pass membrane protein and contains three leucine-rich repeats, one LRRCT domain, and one LRRNT domain. LRR-containing proteins, of which there are greater than 2,000, participate in many important processes, including plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis. A number of microarray expression profiling studies on human cancers have shown that LRRC3B is down-regulated in gastric, breast, colon, testis, prostate and brain cancers, suggesting LRRC3B involvement in carcinogenesis

Gene Name

LRRC3B

Gene ID

116135

UniProt

Q96PB8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYVDHHHHHH

Beschrijving

Source: Human Cells. MW :20kD. Recombinant Human LRRC3B is produced by our Mammalian expression system and the target gene encoding Cys34-Tyr204 is expressed wi

Specificaties

ProductnaamRecombinant humaan Leucine-Rich-herhalingseiwit 3B/LRRC3B (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7585-10