Recombinant humaan Leucine-Rich repeterend eiwit 25/LRRC25 (C-6His)

Source: Human Cells. MW :16.7kD. Recombinant Human LRRC25 is produced by our Mammalian expression system and the target gene encoding Leu21-Thr165 is expressed with a 6His tag at the C-terminus. Leucine-rich repeat-containing protein 25 (LRRC25) is a single-pass type I membrane protein and contains 3 LRR (leucine-rich) repeats. The protein expressed in plasmacytoid dendritic cells (PDC), monocyte-derived dendritic cells (MDDC), granulocytes, monocytes, B-lymphocytes, peripheral blood leukocytes, spleen, bone marrow, and, to a lesser extent, lymph nodes, fetal liver, and appendix but not in thymus. The protein may be involved in the activation of cells of innate and acquired immunity.

LRRC25

126364

Q8N386

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHHHHH