Recombinant humaan Leukocyt Surface Antigen CD47 (C-Fc-Avi)
Gecertificeerd

Recombinant humaan Leukocyt Surface Antigen CD47 (C-Fc-Avi)

Catalog #: 32-8981-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :42.7kD. Recombinant Human Leukocyte Surface Antigen CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a Fc & Avi tag at the C-terminus. CD47 (Integrin-Associated Protein, IAP) is a 40 - 60 kDa variably glycosylated atypical member of the immunoglobulin superfamily. The ubiquitously expressed CD47 binds to SIRP family members on macrophages, neutrophils, and T cells. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Gene Name

CD47

Gene ID

961

UniProt

Q08722

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Beschrijving

Source: Human Cells. MW :42.7kD. Recombinant Human Leukocyte Surface Antigen CD47 is produced by our Mammalian expression system and the target gene encoding Gl

Specificaties

ProductnaamRecombinant humaan Leukocyt Surface Antigen CD47 (C-Fc-Avi)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8981-50