Recombinant humaan leukocytenmono Ig-Like Receptor 2/LMIR2/CD300C (C-6His)

Source: Human Cells. MW :18.89kD. Recombinant Human LMIR2 is produced by our Mammalian expression system and the target gene encoding Gly21-Arg183 is expressed with a 6His tag at the C-terminus. CD300C is a single-pass type I membrane protein which belongs to the immunoregulatory signaling (IRS) family. CD300C contains one Ig-like V-type domain and is present on the surface of natural killer cells, granulocytes, most myeloid cells, dendritic cells, and a subpopulation of T and B lymphocytes. The CD300C (CMRF-35A) and CD300A (CMRF-35H) molecules are homologous leukocyte surface proteins. CD300a and CD300C play an important role in the cross-regulation of TNF-alpha and IFN-alpha secretion from pDCs. CD300A and CD300C are indistinguishable on the surface of NK cells. The ligand for CD300C is presently unknown.

CD300C

10871

Q08708

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRVDHHHHHH