
Recombinant humaan LICHT/HVEM-L/TNFSF14/CD258 (N-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: Human Cells. MW :18.2kD. Recombinant Human LIGHT is produced by our Mammalian expression system and the target gene encoding Leu83-Val240 is expressed with a 6His tag at the N-terminus. Human TNFSF14 Protein, also known as LIGHT, belongs to a member of the tumor necrosis factor (TNF) ligand family. It can bind to NFRSF3/LTBR. It is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and it is also known as a herpesvirus entry mediator ligand (HVEML) . TNFSF14 encodes a protein with a 37 aa cytoplasmic domain, 21aa transmembrane domain and 182 aa extracellular region. The gene is predominantly expressed in the spleen and also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tumor lines. TNFSF14 protein was found to probably function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. Studies have shown that this protein can prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported.
TNFSF14
8740
O43557
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
The product is shipped on dry ice/ice packs.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
HHHHHHGLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Beschrijving
Source: Human Cells. MW :18.2kD. Recombinant Human LIGHT is produced by our Mammalian expression system and the target gene encoding Leu83-Val240 is expressed w
Specificaties
Recent bekeken producten

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL

Stains-all
03943-5
5 g

Sudan Blue II;Oil Blue 35
TRC-S688913-500MG
500 mg

Nile Blue A
N8430-01
1 g

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

Human Apolipoprotein E2 (Apo E2) Antibody
22210-05011
150 µg

MycoBlue Mycoplasma Detector
D101-02
50 Reactions
