Recombinant humaan lysozyme G-like proteïne 2/LYG2 (C-6His)

Source: Human Cells. MW :22.55kD. Recombinant Human Lysozyme G-Like Protein 2 is produced by our Mammalian expression system and the target gene encoding Ser20-Phe212 is expressed with a 6His tag at the C-terminus. Lysozyme G-Like Protein 2 (LYG2) is a secreted protein that belongs to the glycosyl hydrolase 23 family. LYG2 contains one SLT domain, one protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL) . SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc) . LYG2 has hydrolase activity which acting on glycosyl bonds, and possess lysozyme activity.

LYG2

254773

Q86SG7

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,10%Glycerol, pH7.2.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

SYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSFVDHHHHHH