Recombinant Humaan Mitochondriale Missie 1 Proteïne/FIS1 (C-6His)
Gecertificeerd

Recombinant Humaan Mitochondriale Missie 1 Proteïne/FIS1 (C-6His)

Catalog #: 32-8146-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :15.2kD. Recombinant Human Mitochondrial Fission 1 Protein is produced by our E.coli expression system and the target gene encoding Met1-Gly122 is expressed with a 6His tag at the C-terminus. Mitochondrial Fission 1 Protein (FIS1) is a member of the FIS1 family. FIS1 is a single-pass membrane protein and contains one TPR repeat. FIS1 is part of the mitochondrial complex that promotes mitochondrial fission. FIS1 can induce cytochrome C discharge from the mitochondrion to the cytosol, eventually leading to apoptosis. In addition, FIS1 participates in peroxisomal growth and division. The C-terminus of FIS1 is required for mitochondrial or peroxisomal localization, while the N-terminus is necessary for mitochondrial or peroxisomal fission, localization and regulation of the interaction with DNM1L.

Gene Name

FIS1

Gene ID

51024

UniProt

Q9Y3D6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGVEHHHHHH

Beschrijving

Source: E. coli. MW :15.2kD. Recombinant Human Mitochondrial Fission 1 Protein is produced by our E.coli expression system and the target gene encoding Met1-Gly

Specificaties

ProductnaamRecombinant Humaan Mitochondriale Missie 1 Proteïne/FIS1 (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8146-10