Recombinant humaan Neuritin/NRN1 (N-6His)

Source: E. coli. MW :12.1kD. Recombinant Human Neuritin is produced by our E.coli expression system and the target gene encoding Ala28-Gly116 is expressed with a 6His tag at the N-terminus. Neuritin/NRN1 is a member of the neuritin family and can be expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. Neuritin/NRN1 promotes neurite outgrowt, arborization and neuritogenesis. The protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI) -anchored proteins.Overexpression of the encoded protein may be associated with astrocytoma progression.

NRN1

51299

Q9NPD7

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MGSSHHHHHHSSGLVPRGSHMAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG