Recombinant humaan NGAL/lipocaline-2/LCN2 (C-6His, E. coli)
Gecertificeerd

Recombinant humaan NGAL/lipocaline-2/LCN2 (C-6His, E. coli)

Catalog #: 32-8317-10
Maat: 10 µg
Droogijs Vereist

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :21.8kD. Recombinant Human NGAL is produced by our E.coli expression system and the target gene encoding Gln21-Gly198 is expressed with a 6His tag at the C-terminus. Neutrophil gelatinase-associated lipocalin (LCN2) is a secreted protein and belongs to the calycin superfamily. This protein is released from injured tubular cells after various damaging stimuli, is already known by nephrologists as one of the most promising biomarkers of incoming Acute Kidney Injury (AKI) . Recent evidence also suggests its role as a biomarker in a variety of other renal and non-renal conditions. Moreover, recent studies seem to suggest a potential involvement of this factor also in the genesis and progression of chronic kidney diseases. NGAL is the first known mammalian protein which specifically binds organic molecules called siderophores, which are high-affinity iron chelators. NGAL, first known as an antibacterial factor of natural immunity, and an acute phase protein, is currently one of the most interesting and enigmatic proteins involved in the process of tumor development. acting as an intracellular iron carrier and protecting MMP9 from proteolytic degradation, NGAL has a clear pro-tumoral effect, as has already been observed in different tumors (e.g. breast, stomach, oesophagus, brain) in humans. In thyroid carcinomas, NGAL is strongly induced by NF-kB, an important factor involved both in tumor growth and in the link between chronic inflammation and neoplastic development. Thus, Lipocalin-2 (LCN2/NGAL) has been implicated in a variety of processes including cell differentiation, proliferation, survival and morphogenesis.

Gene Name

LCN2

Gene ID

3934

UniProt

P80188

Components

Supplied as a 0.2 μm filtered solution of PBS,50% glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGVEHHHHHH

Beschrijving

Source: E. coli. MW :21.8kD. Recombinant Human NGAL is produced by our E.coli expression system and the target gene encoding Gln21-Gly198 is expressed with a 6H

Specificaties

ProductnaamRecombinant humaan NGAL/lipocaline-2/LCN2 (C-6His, E. coli)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8317-10