Recombinant humaan NIP7/KD93 (N-6His)

Source: E.coli. MW :22.6kD. Recombinant Human NIP7 is produced by our E.coli expression system and the target gene encoding Met1-Thr180 is expressed with a 6His tag at the N-terminus. 60S Ribosome Subunit Biogenesis Protein NIP7 Homolog (NIP7) belongs to the NIP7 family. NIP7 contains one PUA domain, it is essential for the process of proper 27S pre-rRNA and 60S ribosome subunit assembly. NIP7 is a monomer form and interacts with NOL8 and SBDS, and may bind to RNA. In addition, NIP7 is one of the many trans-acting factors required for eukaryotic ribosome biogenesis, which interacts with nascent pre-ribosomal particles and dissociates as they complete maturation and are exported to the cytoplasm.

NIP7

51388

Q9Y221

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0 .

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MGSSHHHHHHSSGLVPRGSHMRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT