Recombinant humaan Nucleobindin-2/Nesfatin-1

Source: E.coli. MW :9.6kD. Recombinant Human Nucleobindin-2 is produced by our E.coli expression system and the target gene encoding Val25-Leu106 is expressed. Nesfatin-1 is a metabolic polypeptide encoded in the N-terminal region of the precursor protein, Nucleobindin2 (NUCB2) . Nesfatin-1 is a neuropeptide produced in the hypothalamus of mammals. It participates in the regulation of hunger and fat storage. Nesfatin-1 is also expressed in other areas of the brain, and in pancreatic islets beta-cells, gastric endocrine cells and adipocytes. Nesfatin-1 suppresses food intake and can regulate energy metabolism in a Leptin independent manner. Nesfatin-1 may also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance.

NUCB2

4925

P80303

Lyophilized from a 0.2 μm filtered solution of 10mM Sodium Phosphate, pH6.5.

The product is shipped on dry ice/ice packs.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL