Recombinant humaan osteocrine (N-6His)

Source: E.coli. MW :14kD. Recombinant Human Osteocrin is produced by our expression system and the target gene encoding Val28-Gly133 is expressed with a 6His tag at the N-terminus. Osteocrin is a secreted protein which is primarily expressed in bone and muscle. It is synthesized as a proprotein that undergoes proteolytic processing to generate a mature 50 amino acid C-terminal active peptide.Human Osteocrin proprotein shares 77% and 78% amino acid sequence identity with the rat and mouse protein, respectively. It appears to modulate osteoblastic differentiation. It could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.

OSTN

344901

P61366

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

The product is shipped on dry ice/ice packs.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG