Recombinant humaan papillomavirus 18

Source : E.Coli The Recombinant HPV-18 is a full length large capsid protein having a Mw of 56kDa expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography. Human papillomavirus family consist of over 200 types. Over than 30 to 40 types of HPV are transferred via sexual contact and infect the anogenital region initiating genital warts. Persistent infection with 'high-risk' HPV types results in skin warts and leads to precancerous lesions and invasive cancer. HPV infection is considered as a source for all incidents of cervical cancer. E2, E6, and E7 proteins of HPV-16 and 18 are considered the main viral oncoproteins that take part in cervical cancer. The type-specific antigen epitopes of E2, E6, and E7 proteins of HPV-16 are fused together and expressed in E. coli for diagnostic purpose.

Papillomavirus||HPV||Papilloma Virus.

Protein is >95% pure as determined by 12% PAGE (Coomassie staining) .

Recombinant HPV-18 solution in Phosphate buffer and 3M Urea and 0.02% sodium azide as preservative.

VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA.