Recombinant humaan parvalbumine a/PVALB (C-6His)

Source: E.coli. MW :13.12kD. Recombinant Human Parvalbumin alpha is produced by our E.coli expression system and the target gene encoding Ser2-Ser110 is expressed with a 6His tag at the C-terminus. Parvalbumin a (PVALB) is a member of the parvalbumin family. PVALB is a high affinity calcium ion-binding protein, with two EF hand domains. PVALB is structurally and functionally similar to calmodulin and troponin C, it can bind two calcium ions. Parvalbumin is thought to be involved in relaxation after contraction in muscle. Parvalbumin is expressed in a specific population of GABAergic interneurons, which are believed to have a role in maintaining the balance between excitation and inhibition in the cortex as well as the hippocampus.

PVALB

5816

P20472

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESLEHHHHHH