Recombinant humaan PD-L1 Fc Fusion Protein (actief)

Host: CHO-K1 celline. PD-L1 (CD274/B7-H1) is a critical membrane-bound costimulatory molecule belongs to the B7 superfamily that inhibits immune responses through its receptor, PD-1 and PD-L1 play a key role in the pathogenesis of inflammatory diseases (programmed death 1) . It is widely expressed in the mononuclear phagocyte system (MPS), may co-stimulate T cells and regulates inflammatory responses. PD-L1 exerts inflammation regulatory functions via a negative co-stimulatory effect on T cell functions to inhibit cytokine secretion, facilitate apoptosis of activated T cells and induce T cell anergy. Aberrant expression and dysregulation of CD274 have been reported during bacterial infection, inflammation and in numerous autoimmune diseases.

B7 homolog 1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1

Functional Assay, ELISA, FACS, WB

99% Purity SDS -PAGE and HPLC.

Lyophilized sterile PBS, 5% trehalose and 0.01% tween 80 are added as protectant before lyophilization.

Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Functional assay: Measured by its binding ability in a functional FLOW . Binding assay was tested using CHO-K1/PD-1 (cat no. 14-500ACL) . Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method

Human PD-L1 (ECD) : MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPV EKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLL KDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA PYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLS GKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENH TAELVIPELPLAHPPNER