Recombinant humaan PDCD5/TFAR19 (N-6His)
Gecertificeerd

Recombinant humaan PDCD5/TFAR19 (N-6His)

Catalog #: 32-8209-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :16.4kD. Recombinant Human Programmed Cell Death Protein 5 is produced by our E.coli expression system and the target gene encoding Met1-Tyr125 is expressed with a 6His tag at the N-terminus. Programmed Cell Death Protein 5 (PDCD5) is a member of the PDCD5 family. PDCD5 is expressed in tumor cells during apoptosis, independent of apoptosis-inducing stimuli. This protein may function in the process of apoptosis. PDCD5 is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. PDCD5 may play an important regulator of K (lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. PDCD5 is an important novel protein that regulates both apoptotic and non-apoptotic programmed cell death.

Gene Name

PDCD5

Gene ID

9141

UniProt

O14737

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Beschrijving

Source: E. coli. MW :16.4kD. Recombinant Human Programmed Cell Death Protein 5 is produced by our E.coli expression system and the target gene encoding Met1-Tyr

Specificaties

ProductnaamRecombinant humaan PDCD5/TFAR19 (N-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8209-10