Recombinant humaan PRL
Gecertificeerd

Recombinant humaan PRL

Catalog #: 32-8677-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :23.9kD. Recombinant Human Prolactin is produced by our Mammalian expression system and the target gene encoding Leu29-Cys227 is expressed with a 6His tag at the C-terminus. Prolactin (PRL) is a secreted neuroendocrine pituitary hormone that acts primarily on the mammary gland to promote lactation, but has pleiotropic effects in both males and females. Non-glycosylated prolactin is produced by the pituitary and packaged in storage granules before secretion, while glycosylated prolactin is reported to be constitutively secreted, have lower biological potency, and be removed from the circulation more quickly. Prolactin is synthesized mainly by the anterior pituitary in all mammals, where secretion is under tonic inhibition by hypothalamic dopamine. In humans, prolactin is also produced peripherally. Prolactin expression is low during early human pregnancy, but increases in late pregnancy. The prolactin receptor (PRLR) is a transmembrane type I glycoprotein that belongs to the cytokine hematopoietic receptor family. prolactin molecule is thought to bind two receptor molecules. In addition to its lactogenic activity, peripherally produced prolactin plays roles in breast and prostate cancer development, regulation of reproductive function, and immunoregulation.

Gene Name

PRL

Gene ID

5617

UniProt

P01236

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCVDHHHHHH

Beschrijving

Source: Human Cells. MW :23.9kD. Recombinant Human Prolactin is produced by our Mammalian expression system and the target gene encoding Leu29-Cys227 is express

Specificaties

ProductnaamRecombinant humaan PRL
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8677-50