Recombinant humaan proline-rijk zuur eiwit 1/PRAP1 (C-6His)
Gecertificeerd

Recombinant humaan proline-rijk zuur eiwit 1/PRAP1 (C-6His)

Catalog #: 32-7755-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :16.04kD. Recombinant Human Proline-Rich Acidic Protein 1 is produced by our Mammalian expression system and the target gene encoding Val21-Gln151 is expressed with a 6His tag at the C-terminus. Proline-rich acidic protein 1, also known as Uterine-specific proline-rich acidic protein, UPA and PRAP1, is a secreted protein. PRAP1 is abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. PRAP1 is up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine. PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells. PRAP1 is suppressed through epigenetic mechanisms involving histone deacetylation and methylation. PRAP1 has been shown to cause cell growth inhibition in cancer cell lines.

Gene Name

PRAP1

Gene ID

118471

UniProt

Q96NZ9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQVDHHHHHH

Beschrijving

Source: Human Cells. MW :16.04kD. Recombinant Human Proline-Rich Acidic Protein 1 is produced by our Mammalian expression system and the target gene encoding Va

Specificaties

ProductnaamRecombinant humaan proline-rijk zuur eiwit 1/PRAP1 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7755-50