Recombinant humaan prostaatspecifiek antigen//PSA/KLK3 (Ala18-Pro261, C-6His)
Gecertificeerd

Recombinant humaan prostaatspecifiek antigen//PSA/KLK3 (Ala18-Pro261, C-6His)

Catalog #: 32-7334-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :27.88kD. Recombinant Human Kallikrein 3 is produced by our Mammalian expression system and the target gene encoding Ala18-Pro261 is expressed with a 6His tag at the C-terminus. Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen members of the Kallikrein subfamily located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.

Gene Name

KLK3

Gene ID

354

UniProt

P07288

Components

Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 2mM CaCl2, pH 6.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPVDHHHHHH

Beschrijving

Source: Human Cells. MW :27.88kD. Recombinant Human Kallikrein 3 is produced by our Mammalian expression system and the target gene encoding Ala18-Pro261 is exp

Specificaties

ProductnaamRecombinant humaan prostaatspecifiek antigen//PSA/KLK3 (Ala18-Pro261, C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7334-10