Recombinant humaan PRV1/CD177 (C-6His)
Gecertificeerd

Recombinant humaan PRV1/CD177 (C-6His)

Catalog #: 32-7396-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :42.33kD. Recombinant Human CD177 is produced by our Mammalian expression system and the target gene encoding Leu22-Gly407 is expressed with a 6His tag at the C-terminus. CD177 is polymorphic and has at least two alleles: PRV1 and NB1. Human PRV1 is a Glycosyl-Phosphatidylinositol (GPI) -linked cell surface glycoprotein that belongs to the uPAR/CD59/Ly6 family of receptors. PRV1 is expressed by neutrophils and neutrophil precursors, and changes in expression serve as diagnostic markers for myeloproliferative disorders such as polycythemia vera and essential thrombocythemia. PRV1 may also be expressed by Erythroblasts, B cells, and Monocytes. NB1, a Glycosyl-Phosphatidylinositol (GPI) -linked cell surface glycoprotein, was first described in a case of neonatal alloimmune neutropenia. It is reported that CD177 functions as a novel heterophilic binding partner that engages PECAM-1 in membrane-proximal IgD6.

Gene Name

CD177

Gene ID

57126

UniProt

Q8N6Q3

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGVDHHHHHH

Beschrijving

Source: Human Cells. MW :42.33kD. Recombinant Human CD177 is produced by our Mammalian expression system and the target gene encoding Leu22-Gly407 is expressed

Specificaties

ProductnaamRecombinant humaan PRV1/CD177 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7396-50