Recombinant humaan regenererend eiwit 1-a/REG1A (C-6His)
Gecertificeerd

Recombinant humaan regenererend eiwit 1-a/REG1A (C-6His)

Catalog #: 32-7481-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :17.31kD. Recombinant Human Regenerating Islet-Derived Protein 1-alpha is produced by our Mammalian expression system and the target gene encoding Gln23-Asn166 is expressed with a 6His tag at the C-terminus. Regenerating Islet-Derived Protein 1-a (REG1A) belongs to the Reg family of secreted proteins with a C-type lectic domain. REG1A is highly expressed levels in fetal and infant brains, much lower in adult brains. REG1A promotes the maintenance and growth of pancreatic islet cells and intestinal villi. In addition to, REG1A Might act as an inhibitor of spontaneous calcium carbonate precipitation and be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.

Gene Name

REG1A

Gene ID

5967

UniProt

P05451

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKNVDHHHHHH

Beschrijving

Source: Human Cells. MW :17.31kD. Recombinant Human Regenerating Islet-Derived Protein 1-alpha is produced by our Mammalian expression system and the target gen

Specificaties

ProductnaamRecombinant humaan regenererend eiwit 1-a/REG1A (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7481-50