Recombinant humaan resistent/RETN/ADSF (C-6His)
Gecertificeerd

Recombinant humaan resistent/RETN/ADSF (C-6His)

Catalog #: 32-8247-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :10.6kD. Recombinant Human Resistin is produced by our E.coli expression system and the target gene encoding Lys19-Pro108 is expressed with a 6His tag at the C-terminus. Resistin known as adipose tissue-specific secretory factor (ADSF) or C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein (XCP1) that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. The length of the resistin pre-peptide in human is 108 amino acid residues and in the mouse and rat it is 114 aa; the molecular weight is ~12.5 kDa. Resistin is a cytokine whose physiologic role has been the subject of much controversy regarding its involvement with obesity and type II diabetes mellitus (T2DM) . Resistin has been shown to cause "high levels of 'bad' cholesterol (low-density lipoprotein or LDL), increasing the risk of heart disease, resistin increases the production of LDL in human liver cells and also degrades LDL receptors in the liver. Potentially links obesity to diabetes.

Gene Name

RETN

Gene ID

56729

UniProt

Q9HD89

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Acetic acid, pH 3.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPLEHHHHHH

Beschrijving

Source: E. coli. MW :10.6kD. Recombinant Human Resistin is produced by our E.coli expression system and the target gene encoding Lys19-Pro108 is expressed with

Specificaties

ProductnaamRecombinant humaan resistent/RETN/ADSF (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8247-50