Recombinant humaan Ribonuclease T2/RNASET2 (C-6His)

Source: Human Cells. MW :28.2kD. Recombinant Human Ribonuclease T2 is produced by our Mammalian expression system and the target gene encoding Asp25-His256 is expressed with a 6His tag at the C-terminus. RNASET2, also known as RNASE6PL, is short for bonuclease T2. It is a 256 aa. protein which belongs to the RNase T2 family. RNASET2 is a secreted protein, and is higher expressed in the temporal lobe and fetal brain. This protein can be inhibited by Zn2+ and Cu2+. It has ribonuclease activity, with higher activity at acidic pH and is probably involved in lysosomal degradation of ribosomal RNA. It also plays a role in cellular RNA catabolism.

RNASET2

8635

O00584

Supplied as a 0.2 μm filtered solution of 20mM TrisHcl, 150mM NaCl,20%Glycerol, pH7.5.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH