Recombinant humaan Stathmine/STMN1 (C-6His)
Gecertificeerd

Recombinant humaan Stathmine/STMN1 (C-6His)

Catalog #: 32-7152-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :18.37kD. Recombinant Human Stathmin is produced by our E.coli expression system and the target gene encoding Ala2-Asp149 is expressed with a 6His tag at the C-terminus. Stathmin (STMN1) is a ubiquitous cytosolic phosphoprotein which belongs to the Stathmin family. STMN1 is expressed in many tissues, with the highest expression in the brain, spinal cord, and cerebellum. It can also be expressed in the colon, ovary, placenta, uterus, and trachea. STMN1 participates in the regulation of the microtubule filament structure by destabilizing microtubules. STMN1 promotes the disassembly of microtubules and prevents assembly. STMN1 is involved in the control of the learned and innate fear. STMN1 is an intracellular relay integrating regulatory signals of the cellular environment and as an Oncoprotein in regulation of the cell cycle. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Mutation in STMN1 effects cell homeostasis that may lead to tumorigenicity.

Gene Name

STMN1

Gene ID

3925

UniProt

P16949

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEADLEHHHHHH

Beschrijving

Source: E.coli. MW :18.37kD. Recombinant Human Stathmin is produced by our E.coli expression system and the target gene encoding Ala2-Asp149 is expressed with a

Specificaties

ProductnaamRecombinant humaan Stathmine/STMN1 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7152-50