
Recombinant humaan Stathmine/STMN1 (C-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: E.coli. MW :18.37kD. Recombinant Human Stathmin is produced by our E.coli expression system and the target gene encoding Ala2-Asp149 is expressed with a 6His tag at the C-terminus. Stathmin (STMN1) is a ubiquitous cytosolic phosphoprotein which belongs to the Stathmin family. STMN1 is expressed in many tissues, with the highest expression in the brain, spinal cord, and cerebellum. It can also be expressed in the colon, ovary, placenta, uterus, and trachea. STMN1 participates in the regulation of the microtubule filament structure by destabilizing microtubules. STMN1 promotes the disassembly of microtubules and prevents assembly. STMN1 is involved in the control of the learned and innate fear. STMN1 is an intracellular relay integrating regulatory signals of the cellular environment and as an Oncoprotein in regulation of the cell cycle. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Mutation in STMN1 effects cell homeostasis that may lead to tumorigenicity.
STMN1
3925
P16949
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEADLEHHHHHH
Beschrijving
Source: E.coli. MW :18.37kD. Recombinant Human Stathmin is produced by our E.coli expression system and the target gene encoding Ala2-Asp149 is expressed with a
Specificaties
Recent bekeken producten

Stains-all
03943-5
5 g

Sudan Blue II;Oil Blue 35
TRC-S688913-500MG
500 mg

Nile Blue A
N8430-01
1 g

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

Human Apolipoprotein E2 (Apo E2) Antibody
22210-05011
150 µg

MycoBlue Mycoplasma Detector
D101-02
50 Reactions

Ar.A4 Agrobacterium ElectroCompetent Cells
1272-36
18x 50 µL

Thymidine Auxotrophic EHA105 Agrobacterium ElectroCompetent Cells
1404-10
5x 50 µL
