Recombinant humaan sulfotransferase 1B1/SULT1B1 (N-6His)

Source: E. coli. MW :36.3kD. Recombinant Human Sulfotransferase 1B1 is produced by our E.coli expression system and the target gene encoding Met1-Ile296 is expressed with a 6His tag at the N-terminus. Sulfotransferase Family Cytosolic 1B Member 1 (SULT1B1) is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. Human SULT1B1 is a 296 amino acid protein that is highly expressed in the liver, peripheral blood leukocytes, colon, small intestine, and spleen. SULT1B1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it can catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.

SULT1B1

27284

O43704

Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.0.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MNHKVHHHHHHMLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI