Recombinant humaan sulfotransferase 1C2/SULT1C2 (N-6His)

Source: E. coli. MW :36.3kD. Recombinant Human Sulfotransferase 1C2 is produced by our E.coli expression system and the target gene encoding Met1-Leu296 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1C2 (SULT1C2) is a cytosolic enzyme member of the Sulfotransferase 1 family. Human SULT1C2 is primarily expressed in the adult stomach, kidney and thyroid gland, and in the fetal kidney and liver. SULT1C2 catalyzes the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT1C2 may be involved in the activation of carcinogenic hyroxylamines. It shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF) .

SULT1C2

6819

O00338

Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.5.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MNHKVHHHHHHMALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL