Recombinant humaan sulfotransferase 2A1/SULT2A1 (N-6His)

Source: E. coli. MW :35.2kD. Recombinant Human Sulfotransferase 2A1 is produced by our E.coli expression system and the target gene encoding Ser2-Glu285 is expressed with a 6His tag at the N-terminus. Bile Salt Sulfotransferase (SULT2A1 (is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. SULT2A1 is primarily expressed in the liver and adrenal tissues, and to a lesser extent in the kidney. SULT2A1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. SULT2A1 may have a role in the inherited adrenal androgen excess.

SULT2A1

6822

Q06520

Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE