Recombinant humaan thioredoxin/TXN (N-6His)
Gecertificeerd

Recombinant humaan thioredoxin/TXN (N-6His)

Catalog #: 32-8106-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :13.9kD. Recombinant Human Thioredoxin is produced by our E.coli expression system and the target gene encoding Met1-Val105 is expressed with a 6His tag at the N-terminus. Thioredoxin (TXN) is a member of the Thioredoxin family. Thioredoxin exists as a disulfide-linked homodimer and contains one Thioredoxin domain. Thioredoxin is up-regulated by ionizing radiation. Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Thioredoxin also plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide.

Gene Name

TXN

Gene ID

7295

UniProt

P10599

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, PH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Beschrijving

Source: E. coli. MW :13.9kD. Recombinant Human Thioredoxin is produced by our E.coli expression system and the target gene encoding Met1-Val105 is expressed wit

Specificaties

ProductnaamRecombinant humaan thioredoxin/TXN (N-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8106-50