Recombinant humaan V-Set en Ig Domain-Behoudende proteïne 2/VSIG2 (C-6His)

Source: Human Cells. MW :24.2kD. Recombinant Human VSIG2 is produced by our Mammalian expression system and the target gene encoding Val24-Ala243 is expressed with a 6His tag at the C-terminus. V-Set and Immunoglobulin Domain-Containing Protein 2 (VSIG2) is presumably a 50-60 kDa single-pass type I transmembrane (glyco) protein which contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. VSIG2 is highly expressed in the stomach, colon, prostate, trachea and thyroid glands and weakly in bladder and lung. V-set domains are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains, in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86, in myelin membrane adhesion molecules, in junction adhesion molecules (JAM), in tyrosine-protein kinase receptors, and in the programmed cell death protein 1 (PD1) . It shows expression in stomach and prostate by Northern blot, and likely participates in cell adhesion. Human VSIG2 precursor is 327 amino acids in length.

VSIG2

23584

Q96IQ7

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAVDHHHHHH