
Recombinant humaan vetzuurbindeiwit 3/FABP3/H-FABAP (N-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: E.coli. MW :17.02kD. Recombinant Human FABP3 is produced by our E.coli expression system and the target gene encoding Val2-Ala133 is expressed with a 6His tag at the N-terminus. Fatty Acid Binding Protein 3 (FABP3) is a small cytoplasmic protein (15 kDa) that is released from cardiac myocytes following an ischemic episode. Like the nine other distinct FABPs that have been identified, FABP3 is involved in active fatty acid metabolism where it transports fatty acids from the cell membrane to mitochondria for oxidation. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-types. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. The FABP3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is also a candidate tumor suppressor gene for human breast cancer. FABP3 is a sensitive biomarker for myocardial infarction and can be detected in the blood within one to three hours of onset of pain.
FABP3
2170
P05413
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 6.5.
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
MGSSHHHHHHSSGLVPRGSHMVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Beschrijving
Source: E.coli. MW :17.02kD. Recombinant Human FABP3 is produced by our E.coli expression system and the target gene encoding Val2-Ala133 is expressed with a 6H
Specificaties
Recent bekeken producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL
Recent gezochte producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Fluorescein Conjugated Affinity Purified Anti-MOUSE IgG + IgM (H&L) (GOAT) Minimum Cross Reactivity to Bovine, Horse and Human S
GWB-5CB439
1 mg

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-50mL
50 mL

Horse Polyclonal Horse anti-Rabbit IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7401-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-50mL
50 mL

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse ImmPRESS(TM) VR Secondary Antibody [HRP Polymer]
MP-6402-NB
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-15mL
15 mL
